PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G088200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 521aa    MW: 56274.4 Da    PI: 7.297
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G088200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.95.1e-42169244277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv gC++dls+ keyh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Manes.14G088200.1.p 169 CQVYGCNKDLSSSKEYHKRHKVCEIHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 244
                          **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.3E-33164230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.428166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.3E-39167247IPR004333Transcription factor, SBP-box
PfamPF031106.0E-32169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MQSWSYVTGG KGLVSDETIS SSDAIAKSKN ALMGCSFGNN MVVSSQQAID NHGFGELMYQ  60
ELTGKQLIDN SIRATLSSEV GGGKIINPFM VSTNAFSVED ESTSRLSSSV VDSNSKDSSF  120
IDLKLGRFGD PGDAQNSKIS KGGSILSSSE SSVPSKRARL GVNSHTAHCQ VYGCNKDLSS  180
SKEYHKRHKV CEIHSKTAKV IVNGIEQRFC QQCSRFHLLA EFDDGKRSCR KRLAGHNERR  240
RKPQVGIHSA RTERLLQSYN GFATSRLHGS ALTSFICQDL LPTDPLHPEK YGTNNWRRQI  300
KIEDGSEFSL LSSIPVTRSI FGESTNRYPH ELGGSNSDSR SLIQDISLGN EHLTAFDTVA  360
TIQGLSGITS SSCALSLLSS QSHNYSSHSA EISMACPVVV TGNNTHYSVT QISEKLTGVS  420
SQASTSGVPN KFSSSGASSA EGSHLGSILM SDGSDAINFD ISDGIYQGSN FMNAKHHLPC  480
EDGTTINLLE LSSQLQRVES QKQSMQAKQE NDAFCWPHIT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-301692421184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818134e-31LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132564e-31LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080418.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X3
TrEMBLA0A067K5H80.0A0A067K5H8_JATCU; Uncharacterized protein
STRINGVIT_17s0000g05020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-46SBP family protein